Proteintech, 83890-5-RR, 4EBP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The 4EBP1 (83890-5-RR) by Proteintech is a Recombinant antibody targeting 4EBP1 in WB, FC (Intra), ELISA applications with reactivity to human samples 83890-5-RR targets 4EBP1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, HL-60 cells, HepG2 cells, HeLa cells, A431 cells Positive FC (Intra) detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information 4EBP1 (4E-BP1) is a translational regulator and functions by sequestering eukaryotic translation initiation factor 4E (eIF4E) from the translation initiation machinery. 4E-BP1 contains at least six phosphorylation sites (Thr37, Thr46, Ser65, Thr70, Ser83, and Ser112), four of which (Thr37, Thr46, Ser65, and Thr70) are known to be regulated by mTOR signaling. Phosphorylation of Thr37 and Thr46 is thought to prime 4E-BP1 for sequential phosphorylation of Ser65 and Thr70, which results in the dissociation of 4E-BP1 from eIF4E. (PMID: 12747827) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species Full Name: eukaryotic translation initiation factor 4E binding protein 1 Calculated Molecular Weight: 118 aa, 12 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC004459 Gene Symbol: EIF4EBP1 Gene ID (NCBI): 1978 RRID: AB_3671473 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.