Proteintech, 83902-7-RR, NDRG2 Recombinant monoclonal antibody

Size: 20ul / 100ul The NDRG2 (83902-7-RR) by Proteintech is a Recombinant antibody targeting NDRG2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83902-7-RR targets NDRG2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HepG2 cells, rat brain tissue, mouse heart tissue, rat heart tissue, human heart tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information N-myc downstream-regulated gene 2 (NDRG2) is a newly identified member of the NDRG family that is highly localized and plays an important role in the regulation of astrocyte function. In astrocytes, NDRG2 affects the regulation of apoptosis, astrogliosis, blood-brain barrier integrity, and glutamate clearance. Several preclinical studies have revealed that NDRG2 is implicated in the pathogenesis of many neurological diseases, such as stroke, neurodegeneration and psychiatric disorders. Recent studies demonstrated that NDRG2 functions as a tumor suppressor and may be a prognostic predictor for many different malignant tumors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2629 Product name: Recombinant human NDRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC010458 Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC Predict reactive species Full Name: NDRG family member 2 Calculated Molecular Weight: 371 aa, 39 kDa Observed Molecular Weight: 41-45 kDa GenBank Accession Number: BC010458 Gene Symbol: NDRG2 Gene ID (NCBI): 57447 RRID: AB_3671484 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UN36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.