Product Description
Size: 20ul / 100ul
The NUCB2/nesfatin-1 (83917-2-RR) by Proteintech is a Recombinant antibody targeting NUCB2/nesfatin-1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples
83917-2-RR targets NUCB2/nesfatin-1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: MCF-7 cells, mouse testis tissue, C6 cells, mouse spleen tissue, mouse brain tissue, rat brain tissue
Positive FC (Intra) detected in: HepG2 cells, A431 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species
Full Name: nucleobindin 2
Calculated Molecular Weight: 50 kDa
Observed Molecular Weight: 45-50 kDa
GenBank Accession Number: NM_005013
Gene Symbol: NUCB2
Gene ID (NCBI): 4925
RRID: AB_3671495
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P80303
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924