Proteintech, 83927-1-RR, CXCR7 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCR7 (83927-1-RR) by Proteintech is a Recombinant antibody targeting CXCR7 in WB, IF/ICC, ELISA applications with reactivity to human samples 83927-1-RR targets CXCR7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, Raji cells, U-87 MG cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a G-protein coupled receptor family member. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. The expression of CXCR7 has been associated with cardiac development, tumor growth, and progression. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species Full Name: chemokine (C-X-C motif) receptor 7 Calculated Molecular Weight: 362 aa, 41 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC036661 Gene Symbol: CXCR7 Gene ID (NCBI): 57007 RRID: AB_3671507 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P25106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.