Iright
BRAND / VENDOR: Proteintech

Proteintech, 83934-2-RR, NEU2 Recombinant monoclonal antibody

CATALOG NUMBER: 83934-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NEU2 (83934-2-RR) by Proteintech is a Recombinant antibody targeting NEU2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 83934-2-RR targets NEU2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IF/ICC detected in: PC-12 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NEU2, also named as Sialidase 2, neuraminidase 2, catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosaccharides. NEU2 is localized in the cytosol and plasma membrane and takes part in myoblast and neuronal differentiation. It is almost undetectable under normal physiological conditions, and was found to be involved into apoptotic events in pancreatic ductal adenocarcinoma, one of the most dangerous cancers due to poor diagnosis and prognosis. (PMID: 30439363) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17386 Product name: Recombinant human NEU2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 66-380 aa of BC107053 Sequence: VQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEYLPQ Predict reactive species Full Name: sialidase 2 (cytosolic sialidase) Calculated Molecular Weight: 380 aa, 42 kDa GenBank Accession Number: BC107053 Gene Symbol: NEU2 Gene ID (NCBI): 4759 RRID: AB_3671516 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y3R4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924