Proteintech, 83968-5-RR, SNAT2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SNAT2 (83968-5-RR) by Proteintech is a Recombinant antibody targeting SNAT2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 83968-5-RR targets SNAT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information SNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23082 Product name: Recombinant human SLC38A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC040342 Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN Predict reactive species Full Name: solute carrier family 38, member 2 Observed Molecular Weight: 56 kDa GenBank Accession Number: BC040342 Gene Symbol: SLC38A2 Gene ID (NCBI): 54407 RRID: AB_3671544 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96QD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.