Iright
BRAND / VENDOR: Proteintech

Proteintech, 83986-2-RR, NMI Recombinant monoclonal antibody

CATALOG NUMBER: 83986-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NMI (83986-2-RR) by Proteintech is a Recombinant antibody targeting NMI in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83986-2-RR targets NMI in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, PC-3 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species Full Name: N-myc (and STAT) interactor Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC001268 Gene Symbol: NMI Gene ID (NCBI): 9111 RRID: AB_3671560 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13287 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924