Proteintech, 83989-3-RR, TPRG1L Recombinant monoclonal antibody

Size: 20ul / 100ul The TPRG1L (83989-3-RR) by Proteintech is a Recombinant antibody targeting TPRG1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 83989-3-RR targets TPRG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Presynaptic protein involved in the synaptic transmission tuning. Regulates synaptic release probability by decreasing the calcium sensitivity of release. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22585 Product name: Recombinant human TPRG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC019034 Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI Predict reactive species Full Name: tumor protein p63 regulated 1-like Observed Molecular Weight: 30 kDa GenBank Accession Number: BC019034 Gene Symbol: TPRG1L Gene ID (NCBI): 127262 RRID: AB_3671564 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T0D9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.