Proteintech, 83994-3-RR, CDK4 Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK4 (83994-3-RR) by Proteintech is a Recombinant antibody targeting CDK4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 83994-3-RR targets CDK4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, MCF-7 cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human cervical squamous cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1-to S-phase transition during the cell cycle, and its expression is primarily controlled at the transcriptional level(PMID:17253961). The CCND1-CDK4 axis is critical not only in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment, which are vital to sustain tumor outgrowth (PMID:21844184). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20538 Product name: Recombinant human CDK4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-303 aa of BC010153 Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Predict reactive species Full Name: cyclin-dependent kinase 4 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC010153 Gene Symbol: CDK4 Gene ID (NCBI): 1019 RRID: AB_3671570 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P11802 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.