Proteintech, 84014-5-RR, SRP54 Recombinant monoclonal antibody

Size: 20ul / 100ul The SRP54 (84014-5-RR) by Proteintech is a Recombinant antibody targeting SRP54 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84014-5-RR targets SRP54 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue, MCF-7 cells, HEK-293 cells, Jurkat cells, RAW 264.7 cells, NIH/3T3 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The signal recognition particle (SRP) is a ribonucleoprotein complex that mediates the targeting of proteins to the endoplasmic reticulum (ER). The complex consists of a 7S (or 7SL) RNA and 6 different proteins, and signal recognition particle 54 (SRP54) is one of them. SRP54 binds to the signal sequence of presecretory protein as they emerge from the translating ribosomes, and then transfers them to translocating chain-associating membrane protein (TRAM). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2327 Product name: Recombinant human SRP54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-505 aa of BC003389 Sequence: DPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM Predict reactive species Full Name: signal recognition particle 54kDa Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC003389 Gene Symbol: SRP54 Gene ID (NCBI): 6729 RRID: AB_3671583 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P61011 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.