Proteintech, 84044-1-RR, Caveolin-1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Caveolin-1 (84044-1-RR) by Proteintech is a Recombinant antibody targeting Caveolin-1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 84044-1-RR targets Caveolin-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, A549 cells, MDA-MB-231 cells Positive IHC detected in: human colon cancer tissue, human colon tissue, human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species Full Name: caveolin 1, caveolae protein, 22kDa Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC006432 Gene Symbol: CAV1 Gene ID (NCBI): 857 RRID: AB_3671611 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q03135 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.