Proteintech, 84045-1-RR, cGAS Recombinant monoclonal antibody

Size: 20ul / 100ul The cGAS (84045-1-RR) by Proteintech is a Recombinant antibody targeting cGAS in WB, IF/ICC, IP, ELISA applications with reactivity to mouse samples 84045-1-RR targets cGAS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, RAW 264.7 cells, C2C12 cells Positive IP detected in: NIH/3T3 cells Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa. Specification Tested Reactivity: mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31677 Product name: Recombinant mouse cGAS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-507 aa of BC145651 Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL Predict reactive species Full Name: RIKEN cDNA E330016A19 gene Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC145651 Gene Symbol: cGAS Gene ID (NCBI): 214763 RRID: AB_3671612 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8C6L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.