Iright
BRAND / VENDOR: Proteintech

Proteintech, 84069-8-RR, CD138/Syndecan-1 Recombinant monoclonal antibody

CATALOG NUMBER: 84069-8-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CD138/Syndecan-1 (84069-8-RR) by Proteintech is a Recombinant antibody targeting CD138/Syndecan-1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 84069-8-RR targets CD138/Syndecan-1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse spleen tissue, human tonsillitis tissue, mouse colon tissue, mouse skin tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information CD138, also named as Syndecan-1 (SDC1), is an integral membrane protein. It participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. It is a heparan sulfate proteoglycan expressed on the surface of, and actively shed by, myeloma cells. Altered syndecan-1 expression has been detected in several different tumor types. CD138 was regarded as a useful marker for labeling normal and neoplastic plasma cells and plasmacytoid lymphomas. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1221 Product name: Recombinant Mouse CD138/Syndecan-1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-252 aa of NM_011519.2 Sequence: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE Predict reactive species Full Name: syndecan 1 Calculated Molecular Weight: 33 kDa GenBank Accession Number: NM_011519.2 Gene Symbol: Sdc1 Gene ID (NCBI): 20969 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18828-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924