Proteintech, 84074-4-RR, NOTCH2 Recombinant monoclonal antibody

Size: 20ul / 100ul The NOTCH2 (84074-4-RR) by Proteintech is a Recombinant antibody targeting NOTCH2 in WB, ELISA applications with reactivity to human samples 84074-4-RR targets NOTCH2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NOTCH2 (Neurogenic locus notch homolog protein 2) belongs to the NOTCH family.. In kidney, previous reports demonstrated that Notch1 and Notch2 were activated in mammalian nephrogenesis (PMID: 24526233). Notch2 is expressed in many cell types of most lineages in the hematolymphoid compartment and has specific roles in differentiation and function of various immune cells. Notch2 is required for development of splenic marginal zone B cells and regulates differentiation of dendritic cells (DCs) in the spleen. Notch2 appears to play some specific roles in the intestinal immunity, given that the fate of mast cells and a subset of DCs is regulated by Notch2 in the intestine. Notch2 also has important roles in helper T cell divergence from naïve CD4 T cells and activation of cytotoxic T cells (PMID: 22695918). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29413 Product name: Recombinant human NOTCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1697-1819 aa of NM_024408 Sequence: VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL Predict reactive species Full Name: Notch homolog 2 (Drosophila) Calculated Molecular Weight: 265 kDa Observed Molecular Weight: 110 kDa, 265kDa GenBank Accession Number: NM_024408 Gene Symbol: NOTCH2 Gene ID (NCBI): 4853 RRID: AB_3671644 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q04721 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.