Iright
BRAND / VENDOR: Proteintech

Proteintech, 84081-4-RR, PCF11 Recombinant monoclonal antibody

CATALOG NUMBER: 84081-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PCF11 (84081-4-RR) by Proteintech is a Recombinant antibody targeting PCF11 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 84081-4-RR targets PCF11 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, Jurkat cells, Neuro-2a cells, RAW 264.7 cells, Positive FC (Intra) detected in: U-2 OS Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information In Saccharomyces cerevisiae, the cleavage/polyadenylation factor Pcf11 is a crucial regulatory factor required for recruiting polyadenylation machinery to elongating RNA polymerase II (RNAPII), and is necessary for correct transcriptional termination. Pcf11 (PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)), is a 1,555 amino acid nuclear protein that is a component of pre-mRNA cleavage complex II. It is suggested that Pcf11 is capable of promoting the dissociation of Pol II elongation complexes from DNA. Pcf11 contains a CTD-interaction domain that binds in a phospho-dependent manner to the heptad repeats within the RNA polymerase II CTD. The gene encoding Pcf11 is located on human chromosoem 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20263 Product name: Recombinant human PCF11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1206-1555 aa of BC146778 Sequence: IPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV Predict reactive species Full Name: PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) Calculated Molecular Weight: 1555 aa, 173 kDa Observed Molecular Weight: 180~200 kDa GenBank Accession Number: BC146778 Gene Symbol: PCF11 Gene ID (NCBI): 51585 RRID: AB_3671649 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O94913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924