Iright
BRAND / VENDOR: Proteintech

Proteintech, 84102-5-RR, TSEN34 Recombinant monoclonal antibody

CATALOG NUMBER: 84102-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TSEN34 (84102-5-RR) by Proteintech is a Recombinant antibody targeting TSEN34 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84102-5-RR targets TSEN34 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, A431 cells, A549 cells, HeLa cells, HCT 116 cells, U2OS cells Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species Full Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34-36 kDa GenBank Accession Number: BC020805 Gene Symbol: TSEN34 Gene ID (NCBI): 79042 RRID: AB_3671667 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BSV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924