Proteintech, 84119-3-RR, TRAPPC4 Recombinant monoclonal antibody

Size: 20ul / 100ul The TRAPPC4 (84119-3-RR) by Proteintech is a Recombinant antibody targeting TRAPPC4 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 84119-3-RR targets TRAPPC4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, HL-60 cells, RAW 264.7 cells, mouse testis tissue, rat testis tissue Positive IP detected in: HL-60 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Transport protein particle (TRAPP, also known as trafficking protein particle), a multimeric guanine nucleotide-exchange factor, regulates multiple membrane trafficking pathways (PMID: 20966969). TRAPPC4, also known as synbindin, is a core component of the TRAPP complexes and one of the essential subunits for guanine nucleotide exchange factor activity for Rab1 GTPase (PMID: 31794024). Deficiencies in vesicular transport mediated by TRAPPC4 have been associated with severe syndromic intellectual disability (PMID: 31794024). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2737 Product name: Recombinant human TRAPPC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC010866 Sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS Predict reactive species Full Name: trafficking protein particle complex 4 Calculated Molecular Weight: 219 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC010866 Gene Symbol: TRAPPC4 Gene ID (NCBI): 51399 RRID: AB_3671682 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.