Iright
BRAND / VENDOR: Proteintech

Proteintech, 84123-3-RR, Synaptotagmin-9 Recombinant monoclonal antibody

CATALOG NUMBER: 84123-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Synaptotagmin-9 (84123-3-RR) by Proteintech is a Recombinant antibody targeting Synaptotagmin-9 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 84123-3-RR targets Synaptotagmin-9 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IF-P detected in: mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-9 (SYT9) is a tandem C2 domain Ca 2+ sensor for exocytosis in neuroendocrine cells (PMID: 36732068). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3520 Product name: Recombinant human SYT9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-319 aa of BC029605 Sequence: LCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNILR Predict reactive species Full Name: synaptotagmin IX Calculated Molecular Weight: 491 aa, 52 kDa Observed Molecular Weight: 52-56 kDa GenBank Accession Number: BC029605 Gene Symbol: Synaptotagmin-9 Gene ID (NCBI): 143425 RRID: AB_3671684 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q86SS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924