Iright
BRAND / VENDOR: Proteintech

Proteintech, 84138-5-RR, CD155/PVR Recombinant monoclonal antibody

CATALOG NUMBER: 84138-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CD155/PVR (84138-5-RR) by Proteintech is a Recombinant antibody targeting CD155/PVR in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84138-5-RR targets CD155/PVR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, A549 cells, HUVEC cells, MKN-45 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD155, also known as PVR, is a type I transmembrane glycoprotein in the immunoglobulin superfamily. It contains three extracellular immunoglobulin-like domains, D1-D3, of which D1 is recognized by the virus. Mature human CD155 consists of a 323 amino acid extracellular domain with one N-terminal V-type and two C2-type Ig-like domains, a 24 amino acid transmembrane segment, and a 50 amino acid cytoplasmic tail. CD155 is thought to play a role in adhesion by interaction with the ECM component vitronectin as well as a role in NK killing of tumor cells. CD155 binds to two receptors of NK cells, CD96 and CD226, and accumulates at cell-cell contact sites, leading to the formation of mature immune synapses between NK cells and target cells. CD155 serves as the entry receptor for poliovirus and thereby mediates human susceptibility to poliovirus infection. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0971 Product name: Recombinant Human CD155/PVR protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-343 aa of BC015542 Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN Predict reactive species Full Name: poliovirus receptor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC015542 Gene Symbol: CD155/PVR Gene ID (NCBI): 5817 RRID: AB_3671698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P15151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924