Proteintech, 84139-4-RR, CD3EAP Recombinant monoclonal antibody

Size: 20ul / 100ul The CD3EAP (84139-4-RR) by Proteintech is a Recombinant antibody targeting CD3EAP in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84139-4-RR targets CD3EAP in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, HeLa cells, K-562 cells, HEK-293T cells, NCI-H1299 cells, HCT 116 cells Positive IF/ICC detected in: A431 cells, A549 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35074 Product name: Recombinant human CD3EAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC038992 Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL Predict reactive species Full Name: CD3e molecule, epsilon associated protein Calculated Molecular Weight: 510 aa, 55 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC038992 Gene Symbol: CD3EAP Gene ID (NCBI): 10849 RRID: AB_3671699 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.