Product Description
Size: 20ul / 100ul
The CD9 (84142-1-RR) by Proteintech is a Recombinant antibody targeting CD9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
84142-1-RR targets CD9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, human urine exosomes, L02 cells, HeLa cells, human placenta tissue, HEK-293 exosomes
Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, which may be due to the difference in glycosylations (PMID: 8701996).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species
Full Name: CD9 molecule
Calculated Molecular Weight: 25 kDa
Observed Molecular Weight: 23 kDa
GenBank Accession Number: NM_001769.4
Gene Symbol: CD9
Gene ID (NCBI): 928
RRID: AB_3671703
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: P21926
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924