Iright
BRAND / VENDOR: Proteintech

Proteintech, 84146-1-RR, ATG4C Recombinant monoclonal antibody

CATALOG NUMBER: 84146-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ATG4C (84146-1-RR) by Proteintech is a Recombinant antibody targeting ATG4C in WB, ELISA applications with reactivity to human samples 84146-1-RR targets ATG4C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Autophagy related 4C cysteine peptidase (ATG4C) is an autophagy regulator responsible for cleaving of pro-LC3 and delipidation of LC3 II. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14207 Product name: Recombinant human ATG4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC033024 Sequence: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGE Predict reactive species Full Name: ATG4 autophagy related 4 homolog C (S. cerevisiae) Calculated Molecular Weight: 458 aa, 52 kDa Observed Molecular Weight: 52-55 kDa GenBank Accession Number: BC033024 Gene Symbol: ATG4C Gene ID (NCBI): 84938 RRID: AB_3671709 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96DT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924