Proteintech, 84163-3-RR, ARL4D Recombinant monoclonal antibody

Size: 20ul / 100ul The ARL4D (84163-3-RR) by Proteintech is a Recombinant antibody targeting ARL4D in WB, ELISA applications with reactivity to human samples 84163-3-RR targets ARL4D in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Y79 cells, HepG2 cells, mouse retina tissue, rat retina tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ARL4D (ADP-ribosylation factor-like protein 4D) is also named as ARF4L. ARL4D is a developmentally regulated member of the ADP-ribosylation factor/ARF-like protein (ARF/ARL) family of Ras-related GTPases. ARL4D interacts with the C-terminal pleckstrin homology (PH) and polybasic c domains of cytohesin-2/ARNO in a GTP-dependent manner. Localization of ARL4D at the plasma membrane is GTP- and N-terminal myristoylation-dependent. ARL4D(Q80L), a putative active form of ARL4D, induced accumulation of cytohesin-2/ARNO at the plasma membrane  (PMID: 17804820). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7369 Product name: Recombinant human ARL4D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC000043 Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR Predict reactive species Full Name: ADP-ribosylation factor-like 4D Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC000043 Gene Symbol: ARL4D Gene ID (NCBI): 379 RRID: AB_3671725 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P49703 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.