Iright
BRAND / VENDOR: Proteintech

Proteintech, 84173-3-RR, DPP3 Recombinant monoclonal antibody

CATALOG NUMBER: 84173-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DPP3 (84173-3-RR) by Proteintech is a Recombinant antibody targeting DPP3 in WB, ELISA applications with reactivity to human samples 84173-3-RR targets DPP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DPP3 (dipeptidyl-peptidase 3), also known as DPPIII, is one of the dipeptidyl aminopeptidases, that belongs to the peptidase M49 family. DPP3 is a metalloenzyme containing one Zn2+ ion in its active site. Furthermore, It was shown to have a novel zinc-binding motif ( HELLGH). DPP3 has been reported as an important enkephalin-degrading enzyme in the central nervous system, in human neutrophils. It has 3 isoforms produced by alternative splicing. Increased activity of DPP3 is associated with endometrial and ovarian cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1022 Product name: Recombinant human DPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 437-737 aa of BC007221 Sequence: LWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA Predict reactive species Full Name: dipeptidyl-peptidase 3 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC007221 Gene Symbol: DPP3 Gene ID (NCBI): 10072 RRID: AB_3671730 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NY33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924