Proteintech, 84189-4-RR, PIAS2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PIAS2 (84189-4-RR) by Proteintech is a Recombinant antibody targeting PIAS2 in WB, ELISA applications with reactivity to human, mouse samples 84189-4-RR targets PIAS2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, mouse testis tissue, HeLa cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PIAS2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. PIAS2 also plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. PIAS2 has 3 isoforms produced by alternative splicing with the MW of 68 kDa, 63 kDa and 45 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9032 Product name: Recombinant human PIAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-346 aa of BC015190 Sequence: MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMC Predict reactive species Full Name: protein inhibitor of activated STAT, 2 Calculated Molecular Weight: 63 kDa, 69 kDa Observed Molecular Weight: 63-68 kDa GenBank Accession Number: BC015190 Gene Symbol: PIAS2 Gene ID (NCBI): 9063 RRID: AB_3671742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75928 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.