Iright
BRAND / VENDOR: Proteintech

Proteintech, 84193-4-RR, LIMPII Recombinant monoclonal antibody

CATALOG NUMBER: 84193-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The LIMPII (84193-4-RR) by Proteintech is a Recombinant antibody targeting LIMPII in WB, ELISA applications with reactivity to human samples 84193-4-RR targets LIMPII in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, Y79 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25908 Product name: Recombinant human LIMPII protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-433 aa of BC021892 Sequence: NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL Predict reactive species Full Name: scavenger receptor class B, member 2 Calculated Molecular Weight: 478 aa, 54 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC021892 Gene Symbol: SCARB2 Gene ID (NCBI): 950 RRID: AB_3671745 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q14108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924