Iright
BRAND / VENDOR: Proteintech

Proteintech, 84199-1-RR, Geminin Recombinant monoclonal antibody

CATALOG NUMBER: 84199-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Geminin (84199-1-RR) by Proteintech is a Recombinant antibody targeting Geminin in IF/ICC, ELISA applications with reactivity to human samples 84199-1-RR targets Geminin in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1076 Product name: Recombinant human GMNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC005185 Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Predict reactive species Full Name: geminin, DNA replication inhibitor Calculated Molecular Weight: 24 kDa GenBank Accession Number: BC005185 Gene Symbol: GMNN Gene ID (NCBI): 51053 RRID: AB_3671754 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75496 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924