Proteintech, 84199-2-RR, Geminin Recombinant monoclonal antibody

Size: 20ul / 100ul The Geminin (84199-2-RR) by Proteintech is a Recombinant antibody targeting Geminin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84199-2-RR targets Geminin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:1000 Background Information GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in inhibiting DNA replication by preventing the incorporation of MCM complex into the pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to the apparent mass of 42.5 kDa and 66 kDa are present. The dimer of geminin(50 kDa) can also be detected. (PMID: 15313623) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1076 Product name: Recombinant human GMNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC005185 Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Predict reactive species Full Name: geminin, DNA replication inhibitor Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 28-29 kDa GenBank Accession Number: BC005185 Gene Symbol: GMNN Gene ID (NCBI): 51053 RRID: AB_3671755 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75496 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.