Iright
BRAND / VENDOR: Proteintech

Proteintech, 84204-5-RR, ABCC5 Recombinant monoclonal antibody

CATALOG NUMBER: 84204-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ABCC5 (84204-5-RR) by Proteintech is a Recombinant antibody targeting ABCC5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84204-5-RR targets ABCC5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, HepG2 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information ABCC5, also named MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercaptopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing of this gene has been detected; however, the complete sequence and translation initiation site are unclear. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31680 Product name: Recombinant human ABCC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of NM_005688 Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 5 Calculated Molecular Weight: 161 kDa Observed Molecular Weight: 161-200 kDa GenBank Accession Number: NM_005688 Gene Symbol: ABCC5 Gene ID (NCBI): 10057 RRID: AB_3671760 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924