Proteintech, 84206-3-RR, CD90 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD90 (84206-3-RR) by Proteintech is a Recombinant antibody targeting CD90 in WB, IF/ICC, ELISA applications with reactivity to rat samples 84206-3-RR targets CD90 in WB, IF/ICC, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: PC-12 cells, rat brain tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species Full Name: Thy-1 cell surface antigen Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_012673.2 Gene Symbol: Thy1 Gene ID (NCBI): 24832 RRID: AB_3671762 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.