Proteintech, 84222-2-RR, NETO2 Recombinant monoclonal antibody

Size: 20ul / 100ul The NETO2 (84222-2-RR) by Proteintech is a Recombinant antibody targeting NETO2 in WB, ELISA applications with reactivity to human, mouse, rat samples 84222-2-RR targets NETO2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, HEK-293 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Neuropilin and tolloid-like 2 (NETO2), a member of the subfamily of CUB domain and LDLa-containing proteins, was identified as an auxiliary protein of neuronal kainate receptors (KARs) and played critical roles in regulating the functions of KARs. It was also able to bind to the active oligomeric form of K+-Cl− cotransporter (KCC2) to enhance its recycling in hippocampal neurons. Recently, elevated mRNA levels of NETO2 were detected in several types of tumors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2971 Product name: Recombinant human NETO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 378-525 aa of BC012381 Sequence: MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF Predict reactive species Full Name: neuropilin (NRP) and tolloid (TLL)-like 2 Calculated Molecular Weight: 525 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC012381 Gene Symbol: NETO2 Gene ID (NCBI): 81831 RRID: AB_3671776 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NC67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.