Proteintech, 84225-2-RR, VDAC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The VDAC2 (84225-2-RR) by Proteintech is a Recombinant antibody targeting VDAC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 84225-2-RR targets VDAC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HuH-7 cells, L02 cells, mouse brain tissue, mouse heart tissue, rat brain tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information VDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and especially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue. (PMID: 22020053) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2266 Product name: Recombinant human VDAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC000165 Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA Predict reactive species Full Name: voltage-dependent anion channel 2 Calculated Molecular Weight: 294 aa, 32 kDa Observed Molecular Weight: 31-33 kDa GenBank Accession Number: BC000165 Gene Symbol: VDAC2 Gene ID (NCBI): 7417 RRID: AB_3671778 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P45880 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.