Proteintech, 84230-4-RR, NPEPPS Recombinant monoclonal antibody

Size: 20ul / 100ul The NPEPPS (84230-4-RR) by Proteintech is a Recombinant antibody targeting NPEPPS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84230-4-RR targets NPEPPS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293T cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NPEPPS, also known as PSA, is a member of the oxytocinase subfamily of the M1 aminopeptidase family. NPEPPS encodes puromycin-sensitive aminopeptidase, a zinc metallopeptidase that hydrolyzes amino acids from the N-terminus of its substrate. The protein has 2 isoforms and is located in the cytoplasm. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36035 Product name: Recombinant human NPEPPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-919 aa of BC065294 Sequence: GKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV Predict reactive species Full Name: aminopeptidase puromycin sensitive Observed Molecular Weight: 103 kDa GenBank Accession Number: BC065294 Gene Symbol: NPEPPS Gene ID (NCBI): 9520 RRID: AB_3671783 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P55786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.