Iright
BRAND / VENDOR: Proteintech

Proteintech, 84239-4-RR, APOBEC3A Recombinant monoclonal antibody

CATALOG NUMBER: 84239-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The APOBEC3A (84239-4-RR) by Proteintech is a Recombinant antibody targeting APOBEC3A in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 84239-4-RR targets APOBEC3A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat colon tissue, HeLa cells, HaCaT cells Positive IF/ICC detected in: THP-1 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18845 Product name: Recombinant human APOBEC3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC126416 Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN Predict reactive species Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A Calculated Molecular Weight: 199 aa, 23 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC126416 Gene Symbol: APOBEC3A Gene ID (NCBI): 200315 RRID: AB_3671792 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924