Proteintech, 84272-1-RR, METTL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The METTL1 (84272-1-RR) by Proteintech is a Recombinant antibody targeting METTL1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84272-1-RR targets METTL1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Caco-2 cells, HuH-7 cells, mouse brain tissue Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7055 Product name: Recombinant human METTL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species Full Name: methyltransferase like 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC000550 Gene Symbol: METTL1 Gene ID (NCBI): 4234 RRID: AB_3671818 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UBP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.