Proteintech, 84276-1-RR, ZNF217 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZNF217 (84276-1-RR) by Proteintech is a Recombinant antibody targeting ZNF217 in WB, IF/ICC, ELISA applications with reactivity to human samples 84276-1-RR targets ZNF217 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, LNCaP cells, Caco-2 cells, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Zinc finger protein 217 (ZNF217) is a member of the Krüppel-like factor transcription factor family. ZNF217 possesses a characteristic structure of zinc finger motifs and plays a crucial role in regulating the biological activities of cells. ZNF217 binds to DNA through its zinc fingers thereby targeting potential protein binding partners to specific sites in the genome. Recent findings have revealed that ZNF217 is strongly associated with multiple aspects of cancer progression, impacting patient prognosis. PMID: 38259608 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19453 Product name: Recombinant human ZNF217 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 707-1043 aa of BC113427 Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP Predict reactive species Full Name: zinc finger protein 217 Calculated Molecular Weight: 1048 aa, 115 kDa Observed Molecular Weight: ~ 130 kDa GenBank Accession Number: BC113427 Gene Symbol: ZNF217 Gene ID (NCBI): 7764 RRID: AB_3671822 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75362 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.