Proteintech, 84283-5-RR, Noggin Recombinant monoclonal antibody

Size: 20ul / 100ul The Noggin (84283-5-RR) by Proteintech is a Recombinant antibody targeting Noggin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84283-5-RR targets Noggin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human placenta tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14. Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with heparin sulfate proteoglycans. In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32755 Product name: Recombinant human NOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-145 aa of BC034027 Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL Predict reactive species Full Name: noggin Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC034027 Gene Symbol: Noggin Gene ID (NCBI): 9241 RRID: AB_3671829 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13253 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.