Proteintech, 84292-4-RR, ADAM17 Recombinant monoclonal antibody

Size: 20ul / 100ul The ADAM17 (84292-4-RR) by Proteintech is a Recombinant antibody targeting ADAM17 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84292-4-RR targets ADAM17 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HCT 116 cells, HUVEC cells, SW480 cells, HeLa cells, RAW 264.7 cells Positive IHC detected in: human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32418 Product name: Recombinant human ADAM17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species Full Name: ADAM metallopeptidase domain 17 Calculated Molecular Weight: 824 aa, 93 kDa Observed Molecular Weight: 100-130 kDa GenBank Accession Number: BC136783 Gene Symbol: ADAM17 Gene ID (NCBI): 6868 RRID: AB_3671836 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P78536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.