Proteintech, 84296-4-RR, ARFGEF2 Recombinant monoclonal antibody

Size: 20ul / 100ul The ARFGEF2 (84296-4-RR) by Proteintech is a Recombinant antibody targeting ARFGEF2 in WB, IHC, ELISA applications with reactivity to human samples 84296-4-RR targets ARFGEF2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, HEK-293T cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35396 Product name: Recombinant human ARFGEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-370 aa of BC050449 Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL Predict reactive species Full Name: ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) Observed Molecular Weight: 202 kDa GenBank Accession Number: BC050449 Gene Symbol: ARFGEF2 Gene ID (NCBI): 10564 RRID: AB_3671837 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6D5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.