Proteintech, 84314-2-RR, ALKBH3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ALKBH3 (84314-2-RR) by Proteintech is a Recombinant antibody targeting ALKBH3 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84314-2-RR targets ALKBH3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, mouse kidney tissue, SGC-7901 cells, mouse heart tissue, rat heart tissue Positive FC (Intra) detected in: PC-3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This antibody specifically recognizes isoform 1 as 33kDa (Uniprot). It is possible that there is ubiquitination modification (PMID: 25944111). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species Full Name: alkB, alkylation repair homolog 3 (E. coli) Calculated Molecular Weight: 286 aa, 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC015155 Gene Symbol: ALKBH3 Gene ID (NCBI): 221120 RRID: AB_3671855 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96Q83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.