Proteintech, 84318-4-RR, ATPBD3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATPBD3 (84318-4-RR) by Proteintech is a Recombinant antibody targeting ATPBD3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 84318-4-RR targets ATPBD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, K-562 cells, HeLa cells, HEK-293 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35037 Product name: Recombinant human ATPBD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_145232 Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS Predict reactive species Full Name: ATP binding domain 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_145232 Gene Symbol: ATPBD3 Gene ID (NCBI): 90353 RRID: AB_3671859 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q7Z7A3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.