Iright
BRAND / VENDOR: Proteintech

Proteintech, 84332-5-RR, UTY Recombinant monoclonal antibody

CATALOG NUMBER: 84332-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The UTY (84332-5-RR) by Proteintech is a Recombinant antibody targeting UTY in WB, IF/ICC, ELISA applications with reactivity to human samples 84332-5-RR targets UTY in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IF/ICC detected in: MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information UTY (Ubiquitously Transcribed Tetratricopeptide Repeat Containing, Y-Linked) is a protein-coding gene located on the Y chromosome. It is the Y-linked homolog of the X-linked gene KDM6A, which encodes a histone demethylase. UTY is involved in the regulation of gene expression and chromatin structure, similar to its X-linked counterpart KDM6A (PMID: 31097364). UTY is expressed in various tissues and is predicted to be involved in transcription, translation, and nucleic acid binding, which are central to the regulation of gene expression during development, immune function, cell proliferation, and differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35806 Product name: Recombinant human UTY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-655 aa of NM_007125.4 Sequence: QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS Predict reactive species Full Name: ubiquitously transcribed tetratricopeptide repeat gene, Y-linked Calculated Molecular Weight: 150kDa,1347aa Observed Molecular Weight: 130-160kDa GenBank Accession Number: NM_007125.4 Gene Symbol: UTY Gene ID (NCBI): 7404 RRID: AB_3671873 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O14607 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924