Proteintech, 84336-6-RR, C5AR1/CD88 Recombinant monoclonal antibody

Size: 20ul / 100ul The C5AR1/CD88 (84336-6-RR) by Proteintech is a Recombinant antibody targeting C5AR1/CD88 in WB, IF/ICC, ELISA applications with reactivity to human samples 84336-6-RR targets C5AR1/CD88 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, U-87 MG cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species Full Name: complement component 5a receptor 1 Calculated Molecular Weight: 39kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_001736.4 Gene Symbol: C5aR Gene ID (NCBI): 728 RRID: AB_3671877 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P21730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.