Proteintech, 84340-2-RR, ORAI3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ORAI3 (84340-2-RR) by Proteintech is a Recombinant antibody targeting ORAI3 in WB, IF/ICC, ELISA applications with reactivity to human samples 84340-2-RR targets ORAI3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, A549 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36135 Product name: Recombinant human ORAI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species Full Name: ORAI calcium release-activated calcium modulator 3 Calculated Molecular Weight: 295 aa, 32 kDa Observed Molecular Weight: ~30 kDa，~60 kDa GenBank Accession Number: BC006126 Gene Symbol: ORAI3 Gene ID (NCBI): 93129 RRID: AB_3671881 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BRQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.