Iright
BRAND / VENDOR: Proteintech

Proteintech, 84341-3-RR, CD33 Recombinant monoclonal antibody

CATALOG NUMBER: 84341-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CD33 (84341-3-RR) by Proteintech is a Recombinant antibody targeting CD33 in WB, IHC, ELISA applications with reactivity to human samples 84341-3-RR targets CD33 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, K-562 cells, U-937 cells, HL-60 cells Positive IHC detected in: human tonsillitis tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2138 Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-259 aa of BC028152 Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH Predict reactive species Full Name: CD33 molecule Calculated Molecular Weight: 364 aa, 40 kDa Observed Molecular Weight: 55-75 kDa GenBank Accession Number: BC028152 Gene Symbol: CD33 Gene ID (NCBI): 945 RRID: AB_3671882 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20138 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924