Iright
BRAND / VENDOR: Proteintech

Proteintech, 84354-1-RR, TRIM43 Recombinant monoclonal antibody

CATALOG NUMBER: 84354-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TRIM43 (84354-1-RR) by Proteintech is a Recombinant antibody targeting TRIM43 in WB, ELISA applications with reactivity to human samples 84354-1-RR targets TRIM43 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A594 cells, Jurkat cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TRIM43 (tripartite motif containing 43), also known as TRIM43A. It is expected to be located in the cytoplasm. The calculated molecular weight of TRIM43 is 52 kDa. TRIM43 was also upregulated in herpesvirus-associated diseases in humans, including γ herpesvirus-associated tumors. As such, TRIM43 and its transcription factor DUX4 could potentially serve as biomarkers of active herpesviral replication and pathogenesis (PMID: 30420784). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34926 Product name: Recombinant human TRIM43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-240 aa of BC015353 Sequence: LLKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKP Predict reactive species Full Name: tripartite motif-containing 43 Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC015353 Gene Symbol: TRIM43 Gene ID (NCBI): 129868 RRID: AB_3671892 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96BQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924