Proteintech, 84365-5-RR, SIGNR1/CD209b Recombinant monoclonal antibody

Size: 20ul / 100ul The SIGNR1/CD209b (84365-5-RR) by Proteintech is a Recombinant antibody targeting SIGNR1/CD209b in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 84365-5-RR targets SIGNR1/CD209b in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information SIGNR1 (CD209b) is a mouse homolog of the human DC-SIGN receptor (PMID: 11581173). SIGNR1 is a type II transmembrane protein with an extracellular domain consisting of a neck region made up of four repeats of 28 amino acids and a carbohydrate recognition domain (PMID: 15583012). It is expressed on marginal zone macrophages and peritoneal macrophages and is a key receptor for the recognition and efficient clearance of pathogens by the innate immune system. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1497 Product name: Recombinant Mouse SIGNR1/CD209b protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 74-325 aa of NM_026972.5 Sequence: QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG Predict reactive species Full Name: CD209b antigen Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: NM_026972.5 Gene Symbol: Cd209b Gene ID (NCBI): 69165 RRID: AB_3671901 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8CJ91-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.