Iright
BRAND / VENDOR: Proteintech

Proteintech, 84367-6-RR, POLR3C Recombinant monoclonal antibody

CATALOG NUMBER: 84367-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The POLR3C (84367-6-RR) by Proteintech is a Recombinant antibody targeting POLR3C in WB, IF/ICC, ELISA applications with reactivity to human samples 84367-6-RR targets POLR3C in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Mutations in the POLR3A, POLR3C, POLR3E, and POLR3F subunits are associated with susceptibility to varicella zoster virus-induced encephalitis and pneumonitis (PMID: 34395528). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27311 Product name: Recombinant human POLR3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-397 aa of BC002586 Sequence: IGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYK Predict reactive species Full Name: polymerase (RNA) III (DNA directed) polypeptide C (62kD) Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC002586 Gene Symbol: POLR3C Gene ID (NCBI): 10623 RRID: AB_3671903 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BUI4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924