Iright
BRAND / VENDOR: Proteintech

Proteintech, 84371-2-RR, FNIP2 Recombinant monoclonal antibody

CATALOG NUMBER: 84371-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FNIP2 (84371-2-RR) by Proteintech is a Recombinant antibody targeting FNIP2 in WB, ELISA applications with reactivity to human samples 84371-2-RR targets FNIP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MDA-MB-231 cells, MDA-MB-453 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Folliculin (FLCN)-interacting proteins 1 and 2 (FNIP1, FNIP2) are homologous binding partners of FLCN, a tumor suppressor for kidney cancer. FNIP2 was found to bind to the C terminus of FLCN and to AMPK, like FNIP1. FNIP2 competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PMID: 18403135). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35014 Product name: Recombinant human FNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 740-885 aa of BC166693 Sequence: ERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEG Predict reactive species Full Name: folliculin interacting protein 2 Observed Molecular Weight: 125 kda GenBank Accession Number: BC166693 Gene Symbol: FNIP2 Gene ID (NCBI): 57600 RRID: AB_3671906 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P278 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924