Proteintech, 84372-4-RR, IKKA Recombinant monoclonal antibody

Size: 20ul / 100ul The IKKA (84372-4-RR) by Proteintech is a Recombinant antibody targeting IKKA in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84372-4-RR targets IKKA in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Daudi cells, HeLa cells, HepG2 cells, RAW 264.7 cells, C6 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species Full Name: conserved helix-loop-helix ubiquitous kinase Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: NM_001278 Gene Symbol: IKK Alpha Gene ID (NCBI): 1147 RRID: AB_3671907 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.